Myotoxin (g.9.1.2)


SCOP classification
 
Class: Small proteins
Fold: Defensin-like
Superfamily: Defensin-like
Family: Myotoxin



Orphan Member
 
Domain: d4gv5c_ of protein: Crotamine from Species: South american rattlesnake (Crotalus durissus terrificus) [TaxId: 8732]




>1z99a1(g.9.1.2)
YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Integrated Structure-Sequence alignment (ClustalO)
Integrated Structure-Sequence alignment (HHAlign)