The protein sequence should be entered as follows :

MGDTGKLGRIIRHDAFQVWEGDEPPKLRYVFLFRNKIMFTEQD ASTSPPSYTHYSSIRLDKYNIRQHTTDEDTIVLQPQEPGLPSF RIKPKDFETSEYVRKAWLRDIAEEQEKYAAERD